Posts Tagged ‘video game’

A Moment of Quiet Reflection

2015/05/11

Recently, for the second time since 2013, numerous websites – or, more correctly said, ones where discourse is dominated by sex-negative gender feminists, social justice extremists, identity politics-obsessed ideologues, and the political correctness brigade – lost their collective minds over a certain character from the highly-anticipated upcoming video game Metal Gear Solid V: The Phantom Pain, whose Play Arts KAI action figure is set to be released just a few short days from now on May 15, 2015. I am referring, of course, to the female sniper known only as Quiet.

Silent but deadly.

Silent but deadly.

While some of the flak the character’s been getting is due to her being a silent female protagonist, the lion’s share of the criticism levied at Konami and Metal Gear Solid creator Hideo Kojima is due to the fact that she looks like she just stepped off the dancing floor in a military-themed strip club. Now, while you don’t have to look too far to find the real world reason behind Quiet’s choice of wardrobe…

Well, at least he's honest.

Well, at least he’s honest.

…what’s far more interesting is what the in-world explanations for her dress sense and economy of speech might be. In spite of the above comments, Kojima has gone on record stating that a lot of thought went into the character’s background and personality…

The guy's been involved with this franchise for 28 years, so I'd trust him at this point. :P

The guy’s been involved with this franchise for 28 years, so I’d trust him at this point. 😛

…and since the entire online brouhaha around Quiet has succeeded in greatly annoying me, I’m going to add my own two cents to the pile of rapidly-accumulating change by taking a closer look at the following video:

The first thing you’ll notice is that Quiet’s introduction reads: “A Sniper deprived of her Words.”

And deprived of much of her clothing as well. ;)

…and much of her clothing as well. 😉

The caption may seem simple, but it speaks volumes (no pun intended): being deprived of something indicates a non-consensual restriction of personal choice, whether through coercion or circumstance. The simplest explanation, of course, would be that Quiet was rendered mute after having previously suffered damage to her vocal cords, but this explanation seems insufficient considering that she can still make certain small noises like gasps and exclamations of surprise or pain. This leaves us with the far more interesting possibility that her inability to speak may be due to shock or psychological trauma – which, given her training as a sniper, is a distinct possibility –  though the most intriguing notion is that her condition may be entirely self-imposed, i.e. that she’s has taken on a vow of silence for some undisclosed reason.

When it comes to Quiet’s skimpy outfit, one perfectly reasonable explanation is that she dresses the way she does due to inherent limits on her superhuman abilities. Take a closer look at her disappearing/reappearing act:

It's like a living version of

It’s like a living version of “The Visible Woman”.

There’s a distinct layering effect to be seen. When she becomes visible, the process goes from the inside out: first her bones and muscles become visible, followed by her skin, and finally her hair, clothing, and accessories. (The aforementioned order is reversed when she vanishes into thin air.) Since it appears to require quite a bit of concentration on her part, it’s possible that there’s an upper limit to the number of layers or the amount of matter that can be affected by her camouflage powers. An excessive amount of padding, accessories, or protective gear might produce an “Invisible Man” effect – where objects are seen floating around in mid-air – something which would severely undermine any stealth or infiltration attempts.

Another possibility is that Quiet’s superhuman acts of physical exertion – she jumped out of a moving helicopter that was a hundred feet in the air and landed on concrete without so much as a scratch, for god’s sake – generate excessive amounts of body heat, more that sweating alone can hope to dissipate and which can only be lost through the emission of higher-than-average levels of thermal radiation through her skin. Wearing too much clothing might cause Quiet to “overheat” and suffer the effects of hyperthermia.

When you get right down to it, though, there’s one catch-all explanation that illustrates just how stupid this controversy is: this is Metal Gear Solid for fuck’s sake. We’re dealing with a video games franchise where we have, among other things:

Good lord, people, if you can accept all of the above without so much as blinking but a mute female sniper dressed like a dockside hooker is what irrevocably violates your suspension of disbelief, that says way more about you than it does about anyone else.

So what’s the real explanation behind Quiet’s appearance and behavior? Well, for now, only Hideo Kojima and his team of developers know for sure. Heck, maybe I do, too. But if that’s the case, then, much like the character at the center of all this, I have good reasons of my own for remaining silent. Ask me again when September 1, 2015 rolls around. 🙂

Strange Moments in Video Gaming – Part 11

2015/04/29

The most memorable thing about NAM-1975 by SNK? For me, it’s the damsel in distress. If you came to her rescue, you didn’t just free a hostage; you gained a comrade-in-arms. 🙂

I've got your female empowerment right here. ;)

I’ve got your female empowerment right here. 😉

Engineering Failures – Part 1

2014/12/30

Unless you’re building a robot to, I don’t know, test motion sickness on amusement park rides, I’m really not too sure why you’d do this either…

I think a better question would be why he programmed your robot dog for nausea too. o_O

I think a better question would be why he programmed your robot dog for nausea too. o_O

Today’s example of questionable coding has been brought to you by Mega Man #43 (January 2015) by Ian Flynn, Powree, and Gary Martin.

And so another year of blogging draws to a close on The Raging Fanboy. A big thank you to all my subscribers, both old and new, for continuing to visit. Please feel free to spread the word and encourage others to visit my little corner of the Internet, as it would be a nice surprise for my blog to experience an increase in traffic for the first time since 2012 by the end of next year. 😦

See you all in 2015! 🙂

Boss, Interrupted

2014/12/26

Hey, villains have to do something to pass the time while waiting for the hero to reach their lair.

There's probably a good reason why "passive-aggressive needlework" isn't a popular form of stress relief.

There’s probably a good reason why “passive-aggressive needlework” isn’t a popular form of therapy or stress relief.

This glimpse into evil hobbies has been brought to you by Mega Man #43 (January 2015) by Ian Flynn, Powree, and Gary Martin.

Strange Moments in Video Gaming – Part 10

2014/09/21

Kids say the darndest things sometimes.

You know your game's controversial when this is one of the LEAST problematic scenes in it. o_O

You know your game’s controversial when this is one of the LEAST problematic scenes in it.  o_O

Today’s nap time has been sponsored by Bernd and the Mystery of Unteralterbach (Bernd und das Rätsel um Unteralterbach) by BerndSoft.

Strange Moments in Video Gaming – Part 9

2014/08/28

There are some words you never expect to appear together in the same sentence.

Wait...wasn't this a deleted scene from "Desperately Seeking Susan"?

Wait…wasn’t this a deleted scene from “Desperately Seeking Susan”?

Today’s word salad comes to you courtesy of Vigilante by Data East.

The Secrets of Wreck-It Ralph – Part 1: Easter Eggs

2013/11/08

Before Wreck-It Ralph premiered in theaters a little over one year ago this month, a couple of online articles – including one featured on GamesRadar – stated that the creative team was toying with the idea of including a trivia track pointing out all of the video game references in the movie when it was released on home video…something that was incentive enough for  me to preorder my copy of the Ultimate Collector’s Edition of the movie. So you can imagine how I disappointed I was to discover that the Blu-Ray special features only included a director’s commentary on deleted scenes from an extremely early version of the movie – which bears only a superficial resemblance to the finished product – and The Gamer’s Guide to Wreck-It Ralph, ten minutes’ worth of short segments narrated by Chris Hardwick that, while entertaining and informative, were the merest shadow of what a genuine trivia track could (and should) have been.

Well, if none exists, then make your own! So, in commemoration of the one-year anniversary of the movie’s release, I’ve decided to write a two-part series filled with trivia about Wreck-It Ralph that other fans and I have stumbled upon after watching the movie way more times than can possibly be considered healthy for normal human beings. Please note that at least some of these easter eggs, especially the text-related ones, will require both a Blu-Ray version of the movie as well as a high definition, large screen television to be visible (and even then just barely).

1. Lies the Trailer Told Me

Movie trailers have become rather infamous for including footage that is taken out of context, misleading, or doesn’t even appear in the film itself. And Wreck-It Ralph is no exception. A hefty chuck of the dialogue and sequences in the original trailer seems to have been created just for it, including an external shot of Litwak’s Family Fun Center sign at around dusk…

thesecretsofwreckitralph-traileronly-litwaksarcade001
…an armorless Wreck-It Ralph hiding behind a rock in Hero’s Duty (“Everything changes now!”)…

thesecretsofwreckitralph-traileronly-everythingchangesnow001
…an unnamed soldier yelling at Ralph (“Get out of this game, buddy!”)…

thesecretsofwreckitralph-traileronly-getoutofthisgamebuddy001
…and Ralph awkwardly riding Sgt. Calhoun’s cruiser to Diet Cola Mountain while being chased by Cy-Bugs (stills of which, in the following collage, have been slotted between the existing scenes from the movie to where they would’ve chronologically fit in).

thesecretsofwreckitralph-traileronly-ralphridingcruiser001
Then there’re some scenes that were altered for aesthetic reasons, such as Sgt. Calhoun being helmetless while speaking to the unnamed female gamer Moppet Girl, presumably so that viewers could get an unobstructed view of her face.

thesecretsofwreckitralph-traileronly-calhounmoppetgirl001
What’s more surprising, though, is that many of the shots from the trailer which, at first glance, appear to have made it into the final movie unaltered actually aren’t. These differences range  from subtle, such as characters or background elements being added, removed, or positioned slightly differently…

thesecretsofwreckitralph-traileronly-scenerydifferences001
…to more profound, such as certain scenes having been completely revised or rewritten. Some examples of the latter include the one where Ralph disembarks from the train upon his initial arrivial in Hero’s Duty

thesecretsofwreckitralph-traileronly-herosdutytraindescent001
…his frantic attempts to flee from the attacking Cy-Bugs and subsequent interaction with Moppet Girl through the First Person Shooter Robot (notice how the trailer features an in-game display name identifying Ralph as “Private Markowski: Explosive Specialist, Heavy Weapons Training”)…

thesecretsofwreckitralph-traileronly-ralphmoppetgirl001
…his reaction to the Cy-Bug-destroying beacon (I think that the trailer’s version of this scene is more impressive than the one in the film, to be honest)…

thesecretsofwreckitralph-traileronly-cybugbeacon001
Fix-It Felix Jr.‘s interaction with Calhoun and the explanation of why he came to Hero’s Duty (note that the background is also completely different in the trailer, with hexagons being the dominant shapes rather than triangles)…

thesecretsofwreckitralph-traileronly-fixitfelixsgtcalhoun001
…the escape pod launch sequence (to say nothing of the completely redesigned launch bay area)…

thesecretsofwreckitralph-traileronly-escapepodlaunch001
…and Ralph looking over a very different incarnation of Sugar Rush from the top of the cliff the shuttle crashed into (as opposed to surveying it from atop the branch of a nearby candy tree).

thesecretsofwreckitralph-traileronly-sugarrushdifferences001
2. High Score Symbolism

If you’ve seen The Gamer’s Guide to Wreck-It Ralph, you probably know that the high score seen on the Fix-It Felix Jr. game cabinet – 120501 – is a reference to Walt Disney’s birthday:  December 5, 1901. So it should come as no surprise that the high score seen on the home video release’s menu screens – 110212 – is also significant: it’s the date of the movie’s release in theaters: November 2, 2012.

thesecretsofwreckitralph-dvdmenuscreen001
3. Déjà Vu

If Fix-It Felix Jr. seems strangely familiar to you, there’s a good reason for that: the game is a pastiche of Donkey Kong, with Wreck-It Ralph and Fix-It Felix Jr. being the direct counterparts of the eponymous gorilla and Mario/Jumpman, respectively, the hero being a handyman of some sort – a carpenter/contractor as opposed to a carpenter/plunber – and using a hammer, and the idea of the villain climbing a building being just a few of the common elements shared by both games. These parallels even extend to the game cabinet designs and artwork themselves, as can be clearly seen in the following image:

Virtual Arcade: Level Two by Lunar Archivist

Virtual Arcade: Level Two by Lunar Archivist

4. Reaching Across Worlds

Never underestimate the resilience of Penny Forrester and George! The lipstick-stained contract from Paperman and one of the “Lost Dog” posters from Bolt are seen pinned to the bulletin board at the Bad-Anon meeting.

thesecretsofwreckitralph-badanonbulletinboard001
5. The Writing on the Wall

While Chris Hardwick pointed out a handful of these in The Gamer’s Guide to Wreck-It Ralph, here’re explanations for all the non-gamers out there of the remaining video game graffiti in-jokes and pop culture references seen scrawled on the walls of Game Central Station.

thesecretsofwreckitralph-gamecentralstationgraffiti001
Aerith Lives: A reference to the character Aerith Gainsborough and her heartbreaking death scene in Final Fantasy VII.

All Your Base Are Belong to Us!: The infamously mangled English translation of a line from the opening cutscene of the side-scrolling shooter Zero Wing.

thesecretsofwreckitralph-gamecentralstationgraffiti002
EZ Living: A reference to Extreme EZ Livin’ 2, a fictional game from an early version of the script that ended up being excised from the final film.

Free Pauline: A nod to Pauline, the damsel-in-distress whom Mario needed to rescue in the original Donkey Kong.

K.C. and Turbo: References to Turbo and his alter ego King Candy, respectively.

l33t and pwned: The leetspeek words for “elite” and “owned”, respectively. Humorously enough, these words appear prominently alongside of “K.C.” and “Turbo” in the above screenshots and could thus be interpreted as “K.C. l33t” and “Turbo Pwned”, hinting at upcoming events and later revelations in the movie.

Leerooooy and Jenkins: References to Leeroy Jenkins, a player character whose recklessness ends up ruining the carefully laid-out attack plans of his fellow World of Warcraft team members and getting them all killed.

No Campers: A reference to the video game tactic of “camping”, where a player remains in a stationary spot on the map that offers some kind of inherent strategic or tactical advantage.

Sheng Long Was Here: A reference to one of Ryu’s victory quotes from Street Fighter II – “You must defeat Sheng Long to stand a chance!” – where “Sheng Long” is a (partial) translation of the Japanese term for “Dragon Punch” (“Shouryuken”) into Chinese. The ambiguous nature of this translation led to the widespread misconception that Sheng Long was the name of a person rather than a special move, a fact that video game magazine Electronic Gaming Monthly took advantage of in order to stage an elaborate (and infamous) April Fool’s Joke in 1992.

6. Shameless Plugging

In Game Central Station, the plug sockets all bear the stamp “MOORE U.S.A.” , a reference to Rich Moore, the director and one of the three writers of the film.

thesecretsofwreckitralph-mooreusa001
And while we’re at it, Private Markowski is named in honor of Steven Markowski, one of the story artists who was credited as the “story watchdog” for the movie.

thesecretsofwreckitralph-stevenmarkowski001

7. The Portraits at Tapper’s

Like the Great Wall of Hollywood at the Brown Derby or the famed New York restaurant Sardi’s, one of the walls at Tapper’s has framed caricatures of many of its most famous customers lining it. There are 38 in all, of which 35 can be positively identified based on screenshots and additional information provided by artist Bobby Pontillas, who drew them together with John Musker. Here’s a quick rundown:

thesecretsofwreckitralph-tapperscaricatures001
Left side of door (top to bottom):
1. Neff from Altered Beast
2. The unnamed frog from Frogger

Right side of door (top to bottom):
3. Fix-It Felix Jr. from Fix-It Felix Jr.
4. Zangief from Street Fighter II

Hallway (top row):
5. The unnamed Roman centurion protagonist from Altered Beast
6. Mr. Egg from Burger Time
7. Unknown; not clearly visible
8. Sagat from Street Fighter II
9. Unknown; not clearly visible
10. Mr. Hot Dog from Burger Time
11. Sorceress (blue-skinned woman from the Bad-Anon meeting)
12. Miles “Tails” Prower from Sonic Championship
13. Ryu from Street Fighter II
14. Ken Masters from Street Fighter II
15. Slick and Sam from Q*bert
16. Chun Li from Street Fighter II
17. Sonic the Hedgehog from Sonic Championship
18. Peter Pepper from Burger Time
19. Saitine (devil-like character from the Bad-Anon meeting)
20. Coily from Q*bert
21. E. Honda from Street Fighter II

Hallway (bottom row):
22. Gilius Thunderhead from Golden Axe
23. Unknown; not clearly visible
24. Mr. Pickle from Burger Time
25. Blanka from Street Fighter II
26. Balrog from Street Fighter II
27. Gene from Fix-It Felix Jr.
28. Guile from Street Fighter II
29. Ugg from Q*bert
30. Thomas Rogan from The House of the Dead
31. M. Bison from Street Fighter II
32. Dr. Ivo “Eggman” Robotnik from Sonic Championship
33. A space invader from Space Invaders
34. Rich Moore, the director of Wreck-It Ralph
35. Q*bert from Q*bert
36. Cyril (the zombie) from The House of the Dead
37. Joe Musashi from Shinobi
38. Dhalsim from Street Fighter II

As a special bonus, here’s a collage of all 27 caricatures that have been released to the public.

thesecretsofwreckitralph-caricaturecollage001
The observant will notice that one not mentioned previously – specifically that of 1011001, the yellow robot with the buzzsaw for hand seen at the Bad-Anon meeting – is among them. While it’s supposedly among the ones present at Tapper’s, I’ve yet to find a clear enough shot from the film that I can use to verify this, so it stays off the official list…for now.

8. Now at Litwak’s Arcade on Route 83

While the exact locatiion of Litwak’s Family Fun Center is never explicitly mentioned in the movie, the fake commercials advertising the arrivals of Wreck-It Ralph, Sugar Rush Speedway, and Hero’s Duty at the arcade all mention that it is located on U.S. Route 83. (For those who’re wondering, the verisimilitude of all this ends here, as the maps do not appear to correspond with any real world location along that extremely lengthy stretch of road).

thesecretsofwreckitralph-herosdutylitwaksarcademap001
This narrows it down to one of six possible states: North Dakota, South Dakota, Nebraska, Kansas, Oklahoma, or Texas. The only outdoor shot we ever see of the building…

thesecretsofwreckitralph-litwaksfamilyfuncenterexternalshot001
…strongly suggests that it’s located in central or southern Texas, as those’re the only area with climates warm enough to support the growth of the giant palm trees seen on the left. The section of elevated highway on the right that runs perpendicular to Route 83 is apparently an interstate highway, which would make it I-10, I-20, I-35, or I-40.

9. The Tough Love Approach

After Ralph steals and dons Markowski’s suit of armor, aside from the binary version of tic-tac-toe being played in the upper right corner, the most noteworthy thing on the helmet’s HUD is a text exchange between one Private Marco and Sergeant Calhoun. These instant messages – which are visible on the center left hand side – hammer home the point that she’s a major hardass (as if that wasn’t abundantly clear already).

YOU HAVE 390,499 UNREAD MESSAGES
SGT. CALHOUN: Report in, Squad! Any of you ladybugs seen Markowski?
PVT. MARCO: Golly, I haven’t seen him since 03:00 hours, Sarge.
SGT. CALHOUN: What was he doing? Practicing the ballet?
PVT. MARCO: He was freaking out, Sarge. Kept going on about the bugs…
PVT. MARCO:  I don’t know if he’s Corps material, Ma’am.
SGT. CALHOUN: Corps material or not, if he doesn’t get his bright, shiny boots
SGT. CALHOUN: back to start pose by quarter drop, I’ll have him transferred to
SGT. CALHOUN: Undead Apocalypse slathered in meat tenderizer.

thesecretsofwreckitralph-marcocalhounexchange001
10. Processing Code

While it’s extremely difficult to make out, what follows is a rough approximation of all the text displayed on the screen of the First-Person Shooter robot from Hero’s Duty:

thesecretsofwreckitralph-fpsrobotdisplay001
*****
_loadingParameters{}

_difficulty=[easy]
_availableRounds{}=[15]
_totalHP=[30]
_bugArmor=[75%]

_maddox=loaded
_marco=loaded
_calhoun=loaded
_ship=loaded
_tower=…

_tower=loaded
****Quarter Alert****
_quarters_inserted=[5]
_quarters_inserted=[6]
_quarters_inserted=[7]
_quarters_inserted=[8]
_initiatePlaySequence{}

_connecting
video feed…

_connected.

_game_start
5 4 3 2 1 0
_offline…

Player Linkup 01 v.12.11.02
Distributed by TobiKomi Co 2012

Hero’s Duty

11. Common Origins

Several of the fictional arcade games in the movie – most notably Fix-It Felix Jr., Sugar Rush Speedway, and Hero’s Duty but also Target Bravo: One Shot, One Kill and Finish Line – were all created by the equally fictional TobiKomi Corporation.

12. Not Just Rose-Colored Glasses

While Felix’s love-at-first-sight reaction towards Calhoun is played for laughs, what makes it doubly amusing is that, upon closer inspection, everything that he says is technically accurate. Her skin texture, which has minor blemishes and even some faint freckles, really is higher definition than his. She even has detailed eyelashes and veins around the edges of her eyeballs!

thesecretsofwreckitralph-highdefinitioncalhoun001
13. User-Unfriendly

When the escape pod from Hero’s Duty experiences engine trouble after entering Suger Rush Speedway, one utterly pointless status message and one completely inappropriate suggestion appear on the shuttle’s navigation screen.

thesecretsofwreckitralph-escapepoderrormessage001
! ENGINE FAILURE !
something has gone terribly wrong

The rest of the message appears to be a random jumble of lower case letters.

thesecretsofwreckitralph-escapepodinappropriatesuggestion001
COLLISION IMMINENT
[] Do a barrel roll!

The remaining items on the list are completely illegible, though what little is visible of the third one on the list – no more than the first three or four words – suggests that it may read, “Please return the tray table to its upright position.” This is far from certain, though.

14. The Good Samaritan and the Ladies’ Man

During the panning shot of Game Central Station which takes place while Calhoun is making her speech about the nature of Cy-Bugs, Peter Pepper is seen offering a pie to Q*bert and his homeless compatriots Ugg, Coily, and Slick. Surge Protector, on the other hand, is seen flirting with – and checking out! – Chun Li and the two unnamed princesses in the very same scene.

thesecretsofwreckitralph-goodsamaritanandladiesman001
15. Candy Car Flavors

According the Kart Bakery’s oven settings, there are five classes of race cars in Sugar Rush Speedway: roadster, coupe, dragster, muscle, and stock.

thesecretsofwreckitralph-candycarclasses001
16. Product Placement

The Kart Bakery’s security guard, Beard Papa, is actually the mascot of a Japanese-owned international confectionary chain store of the same name specializing in cream puffs (a fact that his mumbling “Mmm…cream puffs!” in his sleep is alluding to).

thesecretsofwreckitralph-nutritionfactsbeardpapa001
Note that one of the posters on the booth wall is actually an oversized nutrition label. I suspect that the other posters are something in a similar vein – such as food color or pH charts, baking instructions, etc. – but the writing and images are too small to positively identify anything else.

17. Police Officer’s Motto

Doughnut cops Wynchell and Duncan have badges which read, “To Heat and Serve“.

thesecretsofwreckitralph-toheatandserve001
18. The Turbo Seal of Approval

While I’ve pointed this fact out on this blog once before, it bears repeating that, following the big reveal about King Candy’s true identity of Turbo, for one single frame while he’s glitching back and forth betwen his two identities, he breaks the fourth wall by looking directly at the viewer and giving them a “two thumbs up” sign.

thesecretsofwreckitralph-turmbothumbsup001
19. Switching Rides

I’m not sure how many people noticed this (or how obvious this even is), but, when Vanellope Von Schweetz rescues Ralph during the movie’s climax, she’s seen driving Crumbelina Di Caramello’s race car rather than her own.

thesecretsofwreckitralph-vanellopecrumbelinacar001
For those who’ve only just now become aware of this and are wondering why this is, well it’s due to the fact that her own car was rendered undrivable when,  after being thrown in the air by a Cy-Bug geyser erupting beneath her, it crashed and lost its front right wheel on impact.

thesecretsofwreckitralph-vanellopebrokenwheel001
This, of courses, raises the question of just how she managed to locate Crumbelina’s car amidst all the chaos and destruction. Turns out that she didnt have to glitch all that far to reach it: Crumbelina was seen driving right up to the rainbow bridge leading to the game’s exit while she and the rest of Sugar Rush Speedway’s inhabitants were fleeing from the Cy-Bugs and probably passed Ralph and Vanellope, whose was riding on his shoulder, on the way there.

thesecretsofwreckitralph-crumbelinapullsup001
20. Colleagues to Brothers

This is something that I can’t claim credit for noticing, but it’s pretty neat in its subtlety, so props to whoever it was that originally picked up on it.

While they spend most of the movie apart from each other, it’s interesting to note that Felix seems to sense a growing kinship with Ralph at a subconscious level, something which becomes clear when you take a closer look at the way the former refers to the latter and how it evolves over the course of the movie to suggest an increasing level of affection and intimacy.

thesecretsofwreckitralph-colleaguestobrothers001
21. The 30-Year Grudge

If you ever wondered what the source of Gene’s animosity towards Ralph was, it probably has something to with the fact that he’s the guy who not only has his apartment broken into and trashed at the beginning of each level, but also ends up being manhandled and hurled across the screen to god-knows-where all the time.

thesecretsofwreckitralph-geneislifesbitch001
The fact that the new status quo established at the end of the movie adds being blown up by living dynamite during the Bonus Level to his list of responsibilities probably won’t do much to improve his sunny disposition.

thesecretsofwreckitralph-genelivingdynamite001
22. The Bonus Stage is Acceptance

And, to top it off, here’s another subtle but cute little detail: while Ralph’s job may not have changed, his different outlook on life is clearly reflected in his sprite’s design: he’s gone from sporting a toothy scowl to an equally toothy grin.

thesecretsofwreckitralph-turnthatfrownupsidedown001
And that’s it for Part 1 of this series! Check back soon for Part 2, where we’ll be going over some of the continuity errors and inconsistencies that pop up throughout the movie!

Strange Moments in Video Gaming – Part 8

2013/07/23

Go home, Atlus and CAVE Co. Ltd. Your lawyers are drunk.

DAMN YOU AND YOUR LEGALESE, JAPAN! DAMN YOU TO HELL!

DAMN YOU AND YOUR LEGALESE, JAPAN! DAMN YOU TO HELL!

Level Grinding Into Paste

2012/11/09

Mission objectives and leveling up in Borderlands 2 can be a massive pain in the ass.

You’ve got to be kidding me…oh wait…you ARE.

Borderlands 2 is a copyright and trademark of Gearbox Software, LLC. Special thanks to Jeffrey Mulyadi for the screenshot.

Strange Moments in Video Gaming – Part 7

2012/10/24

I’m not sure what I find more bizarre: the U.S. being in the midst of a crime wave perpetrated by ninjas…

Drugs and ninjas everywhere. Growing up in the 80s was rough, man.

…or that Americans seem to be on a first name basis with the President of the United States.

Well, if I weren’t, then I wouldn’t have inserted those quarters, now would I?

Today’s moment of incomprehensibility courtesy of Bad Dudes Vs. Dragon Ninja by Data East.


%d bloggers like this: